- FAM213A Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-48573
- 0.1 ml
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human, Rat
- FAM213A
- IgG
- Rabbit
- This antibody was developed against a recombinant protein corresponding to amino acids: KFYGPQRRKM MFMGFIRLGV WYNFFRAWNG GFSGNLEGEG FILGGVFVVG SGKQGILLEH REKEFGDKVN LLSVLEAAKM IKPQTLASEK
- peroxiredoxin like 2A
- Adrx, C10orf58, FAM213A, PAMM
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KFYGPQRRKMMFMGFIRLGVWYNFFRAWNGGFSGNLEGEGFILGGVFVVGSGKQGILLEHREKEFGDKVNLLSVLEAAKMIKPQTLASEK
Specifications/Features
Available conjugates: Unconjugated